![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
![]() | Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) ![]() common to all subunits of the GINS complex |
![]() | Family a.278.1.1: PSF1 N-terminal domain-like [158574] (2 proteins) |
![]() | Protein DNA replication complex GINS protein PSF1 [158575] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries) Uniprot Q14691 1-144! Uniprot Q14691 1-145 |
![]() | Domain d2ehoj_: 2eho J: [146857] Other proteins in same PDB: d2ehoa1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehok1, d2ehok2, d2ehok3, d2ehol1, d2ehol2 automated match to d2ehob1 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOPe Domain Sequences for d2ehoj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehoj_ a.278.1.1 (J:) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]} mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs latymrslggdeglditqdmkppks
Timeline for d2ehoj_: