Lineage for d2ehoc2 (2eho C:1-61)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2567330Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 2567331Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. Family d.344.1.2: PSF2 N-terminal domain-like [160065] (1 protein)
    N-terminal part of Pfam PF04128
  6. Protein DNA replication complex GINS protein PSF2 [160066] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [160067] (1 PDB entry)
    Uniprot Q9Y248 1-61
  8. 2567342Domain d2ehoc2: 2eho C:1-61 [146847]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol1, d2ehol2
    complexed with so4

Details for d2ehoc2

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (C:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehoc2 d.344.1.2 (C:1-61) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

SCOPe Domain Coordinates for d2ehoc2:

Click to download the PDB-style file with coordinates for d2ehoc2.
(The format of our PDB-style files is described here.)

Timeline for d2ehoc2: