SCOPe 2.08: Domain d2ehod1: 2eho D:88-192

Lineage for d2ehod1 (2eho D:88-192)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.3: PSF3 C-terminal domain-like [158580] (1 protein)
   C-terminal part of Pfam PF06425

6. Protein GINS complex subunit 3, PSF3 [158581] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158582] (3 PDB entries)
   Uniprot Q9BRX5 88-92

8. Domain d2ehod1: 2eho D:88-192 [146848]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol2
   automated match to d2e9xc1
   complexed with so4

Details for d2ehod1

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (D:) GINS complex subunit 3

SCOPe Domain Sequences for d2ehod1:

Sequence; same for both SEQRES and ATOM records:

>d2ehod1 a.278.1.3 (D:88-192) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
lpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspenadisqsllqtfigrfr
rimdssqnaynedtsalvarldemerglfqtgqkglndfqcwekg

Timeline for d2ehod1:

• d2ehod1 first appeared in SCOP 1.75
  
• d2ehod1 appears in SCOPe 2.07