Lineage for d2ehoe2 (2eho E:166-213)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2216674Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 2216675Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 2216704Family d.344.1.0: automated matches [254227] (1 protein)
    not a true family
  6. 2216705Protein automated matches [254515] (1 species)
    not a true protein
  7. 2216706Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries)
  8. 2216711Domain d2ehoe2: 2eho E:166-213 [238642]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehof2, d2ehof3, d2ehog1, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoj_, d2ehok1, d2ehok3, d2ehol1, d2ehol2
    automated match to d2e9xd2
    complexed with so4

Details for d2ehoe2

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (E:) GINS complex subunit 4

SCOPe Domain Sequences for d2ehoe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehoe2 d.344.1.0 (E:166-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dldsyvflrvrerqenilvepdtdeqrdyvidlekgsqhliryktiap

SCOPe Domain Coordinates for d2ehoe2:

Click to download the PDB-style file with coordinates for d2ehoe2.
(The format of our PDB-style files is described here.)

Timeline for d2ehoe2: