PDB entry 2eho

View 2eho on RCSB PDB site
Description: Crystal structure of human GINS complex
Class: replication
Keywords: protein-protein complex, 4-helical bundle, hydrophobic interaction, REPLICATION
Deposited on 2007-03-07, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: -3.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GINS complex subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRT9
      • modified residue (24)
      • modified residue (44)
      • modified residue (50)
      • modified residue (69)
      • modified residue (71)
      • modified residue (87)
      • modified residue (123)
      • modified residue (138)
    Domains in SCOPe 2.07: d2ehoa1
  • Chain 'B':
    Compound: DNA replication complex GINS protein PSF1
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14691 (1-End)
      • modified residue (1)
      • modified residue (7)
      • modified residue (36)
      • see remark 999 (97)
      • modified residue (106)
      • modified residue (111)
      • modified residue (125)
      • modified residue (140)
    Domains in SCOPe 2.07: d2ehob1
  • Chain 'C':
    Compound: DNA replication complex GINS protein PSF2
    Species: Homo sapiens [TaxId:9606]
    Gene: PSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y248 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (66)
      • modified residue (74)
      • modified residue (87)
      • modified residue (93)
      • modified residue (120)
      • modified residue (151)
      • modified residue (167)
    Domains in SCOPe 2.07: d2ehoc1, d2ehoc2, d2ehoc3
  • Chain 'D':
    Compound: GINS complex subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRX5
      • modified residue (26)
      • modified residue (39)
      • modified residue (111)
      • modified residue (149)
      • modified residue (170)
    Domains in SCOPe 2.07: d2ehod1, d2ehod2
  • Chain 'E':
    Compound: GINS complex subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRT9 (Start-202)
      • modified residue (24)
      • modified residue (44)
      • modified residue (50)
      • modified residue (69)
      • modified residue (71)
      • modified residue (87)
      • modified residue (123)
      • modified residue (138)
    Domains in SCOPe 2.07: d2ehoe1, d2ehoe2
  • Chain 'F':
    Compound: DNA replication complex GINS protein PSF1
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14691 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (7)
      • modified residue (36)
      • see remark 999 (97)
      • modified residue (106)
      • modified residue (111)
      • modified residue (125)
      • modified residue (140)
    Domains in SCOPe 2.07: d2ehof2, d2ehof3
  • Chain 'G':
    Compound: DNA replication complex GINS protein PSF2
    Species: Homo sapiens [TaxId:9606]
    Gene: PSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y248 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (66)
      • modified residue (74)
      • modified residue (87)
      • modified residue (93)
      • modified residue (120)
      • modified residue (151)
      • modified residue (167)
    Domains in SCOPe 2.07: d2ehog1, d2ehog2, d2ehog3
  • Chain 'H':
    Compound: GINS complex subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRX5
      • modified residue (26)
      • modified residue (39)
      • modified residue (111)
      • modified residue (149)
      • modified residue (170)
    Domains in SCOPe 2.07: d2ehoh1, d2ehoh2
  • Chain 'I':
    Compound: GINS complex subunit 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRT9
      • modified residue (24)
      • modified residue (44)
      • modified residue (50)
      • modified residue (69)
      • modified residue (71)
      • modified residue (87)
      • modified residue (123)
      • modified residue (138)
    Domains in SCOPe 2.07: d2ehoi1, d2ehoi2
  • Chain 'J':
    Compound: DNA replication complex GINS protein PSF1
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14691 (1-End)
      • modified residue (1)
      • modified residue (7)
      • modified residue (36)
      • see remark 999 (97)
      • modified residue (106)
      • modified residue (111)
      • modified residue (125)
      • modified residue (140)
    Domains in SCOPe 2.07: d2ehoj_
  • Chain 'K':
    Compound: DNA replication complex GINS protein PSF2
    Species: Homo sapiens [TaxId:9606]
    Gene: PSF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y248 (1-End)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (66)
      • modified residue (74)
      • modified residue (87)
      • modified residue (93)
      • modified residue (120)
      • modified residue (151)
      • modified residue (167)
    Domains in SCOPe 2.07: d2ehok1, d2ehok2, d2ehok3
  • Chain 'L':
    Compound: GINS complex subunit 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Psf3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BRX5
      • modified residue (26)
      • modified residue (39)
      • modified residue (111)
      • modified residue (149)
      • modified residue (170)
    Domains in SCOPe 2.07: d2ehol1, d2ehol2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ehoA (A:)
    dsdggseevvltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakr
    edlkvsihqmemeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafa
    refmantesylknvalkhmppnlqkvdlfravpkpdldsyvflrvrerqenilvepdtde
    qrdyvidlekgsqhliryktiap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoA (A:)
    ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlredlkvsihqmemer
    iryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylknv
    alkhmppnlqkvdlfravpkpdldsyvflrsqhliryktia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ehoB (B:)
    mmfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdli
    ptikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykr
    slatymrslggdeglditqdmkppkslyievr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoB (B:)
    mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip
    tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs
    latymrslggdeglditqdmkppks
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ehoC (C:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlqples
    tqsqdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoC (C:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqdnltlmeintsgtfltqalnhmyklrtn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ehoD (D:)
    mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnav
    pqgsklelplwlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfg
    sqllhfdspenadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgq
    kglndfqcwekgqasqitasnlvqnykkrkftdmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoD (D:)
    eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflenavpqgsklelpl
    wlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspe
    nadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgqkglndfqcwe
    kg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ehoE (E:)
    dsdggseevvltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakr
    edlkvsihqmemeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafa
    refmantesylknvalkhmppnlqkvdlfravpkpdldsyvflrvrerqenilvepdtde
    qrdyvidlekgsqhliryktiap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoE (E:)
    vltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlredlkvsihqmeme
    riryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesylkn
    valkhmppnlqkvdlfravpkpdldsyvflrvrerqenilvepdtdeqrdyvidlekgsq
    hliryktiap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ehoF (F:)
    mmfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdli
    ptikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykr
    slatymrslggdeglditqdmkppkslyievr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoF (F:)
    mmfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdli
    ptikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykr
    slatymrslggdeglditqdmkppks
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ehoG (G:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlqples
    tqsqdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoG (G:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ehoH (H:)
    mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnav
    pqgsklelplwlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfg
    sqllhfdspenadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgq
    kglndfqcwekgqasqitasnlvqnykkrkftdmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoH (H:)
    eayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffldnavpqgsklelpl
    wlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspe
    nadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgqkglndfqcwe
    kgq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ehoI (I:)
    dsdggseevvltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakr
    edlkvsihqmemeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafa
    refmantesylknvalkhmppnlqkvdlfravpkpdldsyvflrvrerqenilvepdtde
    qrdyvidlekgsqhliryktiap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoI (I:)
    ltpaelierleqawmnekfapelleskpeivecvmeqlehmeenlrrakredlkvsihqm
    emeriryvlssylrcrlmkiekffphvlekektrpegepsslspeelafarefmantesy
    lknvalkhmppnlqkvdlfravpkpdldsyvflrvrerqenilvepdtdeqrdyvidlek
    gsqhliryktia
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2ehoJ (J:)
    mmfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdli
    ptikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykr
    slatymrslggdeglditqdmkppkslyievr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoJ (J:)
    mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip
    tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs
    latymrslggdeglditqdmkppks
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2ehoK (K:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnlqples
    tqsqdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoK (K:)
    mmdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcr
    llppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkd
    mwdtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2ehoL (L:)
    mseayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnav
    pqgsklelplwlakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfg
    sqllhfdspenadisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgq
    kglndfqcwekgqasqitasnlvqnykkrkftdmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ehoL (L:)
    eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflnavpqgsklelplw
    lakglfdnkrrilsvelpkiyqegwrtvfsadpnvvdlhkmgphfygfgsqllhfdspen
    adisqsllqtfigrfrrimdssqnaynedtsalvarldemerglfqtgqkglndfqcwek
    gq