Lineage for d2ehok1 (2eho K:62-174)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738971Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 2738972Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 2738985Family a.278.1.2: PSF2 C-terminal domain-like [158577] (1 protein)
    C-terminal part of Pfam PF05916
  6. 2738986Protein DNA replication complex GINS protein PSF2 [158578] (1 species)
  7. 2738987Species Human (Homo sapiens) [TaxId:9606] [158579] (3 PDB entries)
    Uniprot Q9Y248 62-173
  8. 2738994Domain d2ehok1: 2eho K:62-174 [146858]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc2, d2ehoc3, d2ehod1, d2ehod2, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog2, d2ehog3, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok2, d2ehok3, d2ehol1, d2ehol2
    automated match to d2q9qa1
    complexed with so4

Details for d2ehok1

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (K:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehok1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehok1 a.278.1.2 (K:62-174) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
ppewmdveklekmrdherkeetftpmpspyymeltklllnhasdnipkadeirtlvkdmw
dtriaklrvsadsfvrqqeahakldnltlmeintsgtfltqalnhmyklrtnl

SCOPe Domain Coordinates for d2ehok1:

Click to download the PDB-style file with coordinates for d2ehok1.
(The format of our PDB-style files is described here.)

Timeline for d2ehok1: