Lineage for d2ehol2 (2eho L:3-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011286Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 3011287Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 3011306Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
    N-terminal part of Pfam PF06425
  6. 3011307Protein GINS complex subunit 3, PSF3 [160072] (1 species)
  7. 3011308Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
    Uniprot Q9BRX5 1-87
  8. 3011315Domain d2ehol2: 2eho L:3-87 [146861]
    Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol1
    automated match to d2e9xc2
    complexed with so4

Details for d2ehol2

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (L:) GINS complex subunit 3

SCOPe Domain Sequences for d2ehol2:

Sequence, based on SEQRES records: (download)

>d2ehol2 d.344.1.4 (L:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavpq
gsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records): (download)

>d2ehol2 d.344.1.4 (L:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflnavpqgsklelplw
lakglfdnkrrilsve

SCOPe Domain Coordinates for d2ehol2:

Click to download the PDB-style file with coordinates for d2ehol2.
(The format of our PDB-style files is described here.)

Timeline for d2ehol2: