![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243) |
![]() | Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) ![]() associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
![]() | Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein) N-terminal part of Pfam PF06425 |
![]() | Protein GINS complex subunit 3, PSF3 [160072] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries) Uniprot Q9BRX5 1-87 |
![]() | Domain d2ehoh2: 2eho H:3-87 [146855] Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehoc3, d2ehod1, d2ehoe1, d2ehoe2, d2ehof2, d2ehof3, d2ehog1, d2ehog2, d2ehog3, d2ehoh1, d2ehoi1, d2ehoi2, d2ehoj_, d2ehok1, d2ehok2, d2ehok3, d2ehol1 automated match to d2e9xc2 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOPe Domain Sequences for d2ehoh2:
Sequence, based on SEQRES records: (download)
>d2ehoh2 d.344.1.4 (H:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavpq gsklelplwlakglfdnkrrilsve
>d2ehoh2 d.344.1.4 (H:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} eayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffldnavpqgsklelpl wlakglfdnkrrilsve
Timeline for d2ehoh2: