Lineage for d2q9qa2 (2q9q A:1-61)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011286Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
    beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)
  4. 3011287Superfamily d.344.1: PriA/YqbF domain [160059] (5 families) (S)
    associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)
  5. 3011316Family d.344.1.0: automated matches [254227] (1 protein)
    not a true family
  6. 3011317Protein automated matches [254515] (1 species)
    not a true protein
  7. 3011318Species Human (Homo sapiens) [TaxId:9606] [255135] (3 PDB entries)
  8. 3011319Domain d2q9qa2: 2q9q A:1-61 [150157]
    Other proteins in same PDB: d2q9qa1, d2q9qb1, d2q9qb2, d2q9qc_, d2q9qd1, d2q9qd2, d2q9qe1, d2q9qf1, d2q9qf2, d2q9qg_, d2q9qh1, d2q9qh2
    automated match to d2q9qa2

Details for d2q9qa2

PDB Entry: 2q9q (more details), 2.36 Å

PDB Description: The crystal structure of full length human GINS complex
PDB Compounds: (A:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2q9qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q9qa2 d.344.1.0 (A:1-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

SCOPe Domain Coordinates for d2q9qa2:

Click to download the PDB-style file with coordinates for d2q9qa2.
(The format of our PDB-style files is described here.)

Timeline for d2q9qa2:

3011319
d2q9qa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2q9qa1