Lineage for d5kaiz_ (5kai Z:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024237Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 3024238Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 3024239Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 3024240Species Thermosynechococcus elongatus [TaxId:146786] [161058] (9 PDB entries)
    Uniprot Q8DHJ2 1-62
  8. 3024245Domain d5kaiz_: 5kai Z: [327769]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_
    automated match to d4pj0z_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaiz_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5kaiz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaiz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5kaiz_:

Click to download the PDB-style file with coordinates for d5kaiz_.
(The format of our PDB-style files is described here.)

Timeline for d5kaiz_: