| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries) Uniprot Q8DHA7 1-36 |
| Domain d5kaim1: 5kai M:2-33 [339516] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_ automated match to d2axtm1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaim1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaim1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
evnqlgliatalfvlvpsvfliilyvqtesqq
Timeline for d5kaim1: