SCOPe 2.08: Domain d5kaim1: 5kai M:2-33

Lineage for d5kaim1 (5kai M:2-33)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
   Uniprot Q8DHA7 1-36

8. Domain d5kaim1: 5kai M:2-33 [339516]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d2axtm1
   complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaim1

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d5kaim1:

Sequence; same for both SEQRES and ATOM records:

>d5kaim1 f.23.35.1 (M:2-33) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
evnqlgliatalfvlvpsvfliilyvqtesqq

Timeline for d5kaim1:

• d5kaim1 first appeared in SCOPe 2.06
  
• d5kaim1 appears in SCOPe 2.07