Lineage for d5kaii1 (5kai i:2-36)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227432Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2227433Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2227434Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2284443Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)
  8. 2284444Domain d5kaii1: 5kai i:2-36 [327745]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4ub8i_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaii1

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5kaii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaii1 f.23.37.1 (i:2-36) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
etlkitvyivvtffvllfvfgflsgdparnpkrkd

SCOPe Domain Coordinates for d5kaii1:

Click to download the PDB-style file with coordinates for d5kaii1.
(The format of our PDB-style files is described here.)

Timeline for d5kaii1:

  • d5kaii1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-30