SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kaii1 (5kai i:2-36)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227432Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2227433Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2227434Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2284443Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)
  8. 2284444Domain d5kaii1: 5kai i:2-36 [327745]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4ub8i_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaii1

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5kaii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaii1 f.23.37.1 (i:2-36) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
etlkitvyivvtffvllfvfgflsgdparnpkrkd

SCOPe Domain Coordinates for d5kaii1:

Click to download the PDB-style file with coordinates for d5kaii1.
(The format of our PDB-style files is described here.)

Timeline for d5kaii1:

  • d5kaii1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-30