Lineage for d5kaix_ (5kai X:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227482Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2227483Family f.23.40.1: PsbX-like [267615] (2 protein domains)
  6. 2227487Protein automated matches [267680] (2 species)
    not a true protein
  7. 2227488Species Thermosynechococcus elongatus [TaxId:197221] [311275] (7 PDB entries)
  8. 2284439Domain d5kaix_: 5kai X: [327740]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaiz_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaix_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d5kaix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaix_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d5kaix_:

Click to download the PDB-style file with coordinates for d5kaix_.
(The format of our PDB-style files is described here.)

Timeline for d5kaix_:

  • d5kaix_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30