SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kaib_ (5kai B:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2228845Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2228846Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2228847Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 protein domains)
    Pfam PF00421
  6. 2228863Protein automated matches [191285] (2 species)
    not a true protein
  7. 2228866Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (13 PDB entries)
  8. 2284450Domain d5kaib_: 5kai B: [327751]
    Other proteins in same PDB: d5kaia_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4il6b_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaib_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (B:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d5kaib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaib_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttr

SCOPe Domain Coordinates for d5kaib_:

Click to download the PDB-style file with coordinates for d5kaib_.
(The format of our PDB-style files is described here.)

Timeline for d5kaib_:

  • d5kaib_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30