SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kaij_ (5kai J:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227352Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2227353Family f.23.32.1: PsbJ-like [161022] (2 protein domains)
    Pfam PF01788
  6. 2227362Protein automated matches [191002] (3 species)
    not a true protein
  7. 2283986Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries)
  8. 2284449Domain d5kaij_: 5kai J: [327750]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4ub8j_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaij_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5kaij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaij_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5kaij_:

Click to download the PDB-style file with coordinates for d5kaij_.
(The format of our PDB-style files is described here.)

Timeline for d5kaij_:

  • d5kaij_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30