SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kaih_ (5kai h:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227370Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (1 family) (S)
    automatically mapped to Pfam PF00737
  5. 2227371Family f.23.33.1: PsbH-like [161026] (2 protein domains)
    Pfam PF00737
  6. 2227372Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2227373Species Thermosynechococcus elongatus [TaxId:146786] [161028] (3 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 2284440Domain d5kaih_: 5kai h: [327741]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4pj0h_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaih_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5kaih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaih_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5kaih_:

Click to download the PDB-style file with coordinates for d5kaih_.
(The format of our PDB-style files is described here.)

Timeline for d5kaih_:

  • d5kaih_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30