Lineage for d5kaih_ (5kai h:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026489Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 3026490Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 3026491Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 3026492Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 3026499Domain d5kaih_: 5kai h: [327741]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4pj0h_
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaih_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (h:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5kaih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaih_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka

SCOPe Domain Coordinates for d5kaih_:

Click to download the PDB-style file with coordinates for d5kaih_.
(The format of our PDB-style files is described here.)

Timeline for d5kaih_: