Lineage for d5kaif_ (5kai F:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227446Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2227447Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2227467Protein automated matches [191000] (4 species)
    not a true protein
  7. 2283301Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)
  8. 2284448Domain d5kaif_: 5kai F: [327749]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaif_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5kaif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaif_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5kaif_:

Click to download the PDB-style file with coordinates for d5kaif_.
(The format of our PDB-style files is described here.)

Timeline for d5kaif_:

  • d5kaif_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30