![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
![]() | Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
![]() | Protein automated matches [191000] (6 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries) |
![]() | Domain d5kaie_: 5kai e: [327778] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_ automated match to d2axte1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaie_ f.23.38.1 (e:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs iplvtdrfeakqqvetfleqlk
Timeline for d5kaie_: