![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.0: automated matches [327289] (1 protein) not a true family |
![]() | Protein automated matches [327290] (1 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries) |
![]() | Domain d5kaik_: 5kai K: [327764] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_ automated match to d2axtk1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaik_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaik_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d5kaik_: