SCOPe 2.07: Domain d5kaik_: 5kai K:

Lineage for d5kaik_ (5kai K:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.0: automated matches [327289] (1 protein)
   not a true family

6. Protein automated matches [327290] (1 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)

8. Domain d5kaik_: 5kai K: [327764]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d2axtk1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaik_

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kaik_:

Sequence; same for both SEQRES and ATOM records:

>d5kaik_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d5kaik_:

• d5kaik_ first appeared in SCOPe 2.06