SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kaik_ (5kai K:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227418Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2283988Family f.23.36.0: automated matches [327289] (1 protein)
    not a true family
  6. 2283989Protein automated matches [327290] (1 species)
    not a true protein
  7. 2283990Species Thermosynechococcus elongatus [TaxId:197221] [327291] (3 PDB entries)
  8. 2284463Domain d5kaik_: 5kai K: [327764]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaio_, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaik_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kaik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaik_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5kaik_:

Click to download the PDB-style file with coordinates for d5kaik_.
(The format of our PDB-style files is described here.)

Timeline for d5kaik_:

  • d5kaik_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30