Lineage for d5kaik_ (5kai K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026696Family f.23.36.0: automated matches [327289] (1 protein)
    not a true family
  6. 3026697Protein automated matches [327290] (1 species)
    not a true protein
  7. 3026698Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)
  8. 3026701Domain d5kaik_: 5kai K: [327764]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaik_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kaik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaik_ f.23.36.0 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5kaik_:

Click to download the PDB-style file with coordinates for d5kaik_.
(The format of our PDB-style files is described here.)

Timeline for d5kaik_: