SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmcf1 (5tmc F:73-257)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014239Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2014240Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2014241Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 protein domains)
  6. 2014257Protein Sigma70 [88948] (2 species)
  7. 2014260Species Thermus thermophilus [TaxId:274] [88949] (10 PDB entries)
    Uniprot Q9WX78
  8. 2283287Domain d5tmcf1: 5tmc F:73-257 [326588]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf2, d5tmcf3
    automated match to d1smyf3
    complexed with g4p, mg, po4, zn

Details for d5tmcf1

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcf1 a.177.1.1 (F:73-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart

SCOPe Domain Coordinates for d5tmcf1:

Click to download the PDB-style file with coordinates for d5tmcf1.
(The format of our PDB-style files is described here.)

Timeline for d5tmcf1:

  • d5tmcf1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24