SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmca2 (5tmc A:50-172)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211367Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2211368Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2211369Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 protein domains)
  6. 2211370Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2211385Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2283204Domain d5tmca2: 5tmc A:50-172 [326505]
    Other proteins in same PDB: d5tmca1, d5tmcb1, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smya2
    complexed with g4p, mg, po4, zn

Details for d5tmca2

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d5tmca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmca2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d5tmca2:

Click to download the PDB-style file with coordinates for d5tmca2.
(The format of our PDB-style files is described here.)

Timeline for d5tmca2:

  • d5tmca2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24