Lineage for d5tmcc_ (5tmc C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 protein domains)
  6. 2574291Protein RNA-polymerase beta [64488] (2 species)
  7. 2574297Species Thermus thermophilus [TaxId:274] [75609] (9 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 2574307Domain d5tmcc_: 5tmc C: [326541]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smyc_
    complexed with g4p, mg, po4, zn

Details for d5tmcc_

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d5tmcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr

SCOPe Domain Coordinates for d5tmcc_:

Click to download the PDB-style file with coordinates for d5tmcc_.
(The format of our PDB-style files is described here.)

Timeline for d5tmcc_: