Lineage for d5tmcf1 (5tmc F:73-257)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348998Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2348999Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2349000Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2349016Protein Sigma70 [88948] (2 species)
  7. 2349019Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries)
    Uniprot Q9WX78
  8. 2349036Domain d5tmcf1: 5tmc F:73-257 [326588]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf2, d5tmcf3
    automated match to d1smyf3
    complexed with g4p, mg, po4, zn

Details for d5tmcf1

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmcf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcf1 a.177.1.1 (F:73-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr
akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl
rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia
dqart

SCOPe Domain Coordinates for d5tmcf1:

Click to download the PDB-style file with coordinates for d5tmcf1.
(The format of our PDB-style files is described here.)

Timeline for d5tmcf1: