Class a: All alpha proteins [46456] (289 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein Sigma70 [88948] (2 species) |
Species Thermus thermophilus [TaxId:274] [88949] (11 PDB entries) Uniprot Q9WX78 |
Domain d5tmcf1: 5tmc F:73-257 [326588] Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf2, d5tmcf3 automated match to d1smyf3 complexed with g4p, mg, po4, zn |
PDB Entry: 5tmc (more details), 2.71 Å
SCOPe Domain Sequences for d5tmcf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tmcf1 a.177.1.1 (F:73-257) Sigma70 {Thermus thermophilus [TaxId: 274]} pkistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvr akilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanl rlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraia dqart
Timeline for d5tmcf1: