Lineage for d5tmcb2 (5tmc B:50-172)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211367Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2211368Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2211369Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 protein domains)
  6. 2211370Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2211385Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2283276Domain d5tmcb2: 5tmc B:50-172 [326577]
    Other proteins in same PDB: d5tmca1, d5tmcb1, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smya2
    complexed with g4p, mg, po4, zn

Details for d5tmcb2

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d5tmcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d5tmcb2:

Click to download the PDB-style file with coordinates for d5tmcb2.
(The format of our PDB-style files is described here.)

Timeline for d5tmcb2:

  • d5tmcb2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24