SCOPe 2.08: Domain d5tmcf2: 5tmc F:258-318

Lineage for d5tmcf2 (5tmc F:258-318)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.1: Sigma3 domain [88660] (3 proteins)

6. Protein Sigma70 [88661] (2 species)

7. Species Thermus thermophilus [TaxId:274] [88662] (11 PDB entries)
   Uniprot Q9WX78

8. Domain d5tmcf2: 5tmc F:258-318 [326589]
   Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf3
   automated match to d1smyf1
   complexed with g4p, mg, po4, zn

Details for d5tmcf2

PDB Entry: 5tmc, 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure

PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmcf2:

Sequence; same for both SEQRES and ATOM records:

>d5tmcf2 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

Timeline for d5tmcf2:

• d5tmcf2 first appeared in SCOPe 2.06
  
• d5tmcf2 appears in SCOPe 2.07