Lineage for d5tmcf2 (5tmc F:258-318)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984585Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1984586Family a.4.13.1: Sigma3 domain [88660] (3 protein domains)
  6. 1984598Protein Sigma70 [88661] (1 species)
  7. 1984599Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries)
    Uniprot Q9WX78
  8. 2283288Domain d5tmcf2: 5tmc F:258-318 [326589]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf3
    automated match to d1smyf1
    complexed with g4p, mg, po4, zn

Details for d5tmcf2

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d5tmcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcf2 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d5tmcf2:

Click to download the PDB-style file with coordinates for d5tmcf2.
(The format of our PDB-style files is described here.)

Timeline for d5tmcf2:

  • d5tmcf2 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24