Lineage for d5tmcb1 (5tmc B:1-49,B:173-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958165Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2958211Domain d5tmcb1: 5tmc B:1-49,B:173-238 [326576]
    Other proteins in same PDB: d5tmca2, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smya1
    complexed with g4p, mg, po4, zn

Details for d5tmcb1

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d5tmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcb1 d.74.3.1 (B:1-49,B:173-238) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapee

SCOPe Domain Coordinates for d5tmcb1:

Click to download the PDB-style file with coordinates for d5tmcb1.
(The format of our PDB-style files is described here.)

Timeline for d5tmcb1: