SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmcb1 (5tmc B:1-49,B:173-238)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2179629Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2179755Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2179756Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 protein domains)
  6. 2179757Protein RNA polymerase alpha [55259] (3 species)
  7. 2179772Species Thermus thermophilus [TaxId:274] [75478] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2283275Domain d5tmcb1: 5tmc B:1-49,B:173-238 [326576]
    Other proteins in same PDB: d5tmca2, d5tmcb2, d5tmcc_, d5tmcd_, d5tmce_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smya1
    complexed with g4p, mg, po4, zn

Details for d5tmcb1

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d5tmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmcb1 d.74.3.1 (B:1-49,B:173-238) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapee

SCOPe Domain Coordinates for d5tmcb1:

Click to download the PDB-style file with coordinates for d5tmcb1.
(The format of our PDB-style files is described here.)

Timeline for d5tmcb1:

  • d5tmcb1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-24