SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tmce_ (5tmc E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2013115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2013116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 protein domains)
    4 helices; irregular array
  6. 2013117Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2013135Species Thermus thermophilus [TaxId:274] [74729] (11 PDB entries)
    Uniprot Q8RQE7; part of multichain biological unit
  8. 2283229Domain d5tmce_: 5tmc E: [326530]
    Other proteins in same PDB: d5tmca1, d5tmca2, d5tmcb1, d5tmcb2, d5tmcc_, d5tmcd_, d5tmcf1, d5tmcf2, d5tmcf3
    automated match to d1smye_
    complexed with g4p, mg, po4, zn

Details for d5tmce_

PDB Entry: 5tmc (more details), 2.71 Å

PDB Description: re-refinement of thermus thermopiles dna-directed rna polymerase structure
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d5tmce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tmce_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOPe Domain Coordinates for d5tmce_:

Click to download the PDB-style file with coordinates for d5tmce_.
(The format of our PDB-style files is described here.)

Timeline for d5tmce_:

  • d5tmce_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-24