![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
![]() | Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) ![]() automatically mapped to Pfam PF02605 |
![]() | Family f.31.1.1: Photosystem I reaction center subunit XI, PsaL [81567] (2 proteins) |
![]() | Protein automated matches [347525] (2 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [347526] (2 PDB entries) |
![]() | Domain d6uzv0_: 6uzv 0: [392502] Other proteins in same PDB: d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_ automated match to d1jb0l_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzv0_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzv0_ f.31.1.1 (0:) automated matches {Synechocystis sp. [TaxId: 1111708]} nqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyfligp wtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqfa agffvggmggafvayfllenlsvvdgifrglfn
Timeline for d6uzv0_: