Lineage for d6uzv7_ (6uzv 7:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631539Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 2631540Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)
  6. 2631552Protein automated matches [236565] (3 species)
    not a true protein
  7. 2631555Species Synechocystis sp. [TaxId:1111708] [347611] (2 PDB entries)
  8. 2631558Domain d6uzv7_: 6uzv 7: [392518]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvl_
    automated match to d4kt0j_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv7_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (7:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6uzv7_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzv7_ f.23.18.1 (7:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdglksflstapvmimalltftagiliefnrfypdllfh

SCOPe Domain Coordinates for d6uzv7_:

Click to download the PDB-style file with coordinates for d6uzv7_.
(The format of our PDB-style files is described here.)

Timeline for d6uzv7_: