![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (7 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [347297] (2 PDB entries) |
![]() | Domain d6uzv1_: 6uzv 1: [392504] Other proteins in same PDB: d6uzv0_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_ automated match to d5oy0a_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzv1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzv1_ f.29.1.1 (1:) automated matches {Synechocystis sp. [TaxId: 1111708]} kvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdledvsrki fsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgilngdvgg gfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapklewfqn vesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefilepskmael ypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiiaghmyr tnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiivaqhmya mppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlldrmlrh rdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvqhlhtl apgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtalillkg vlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhfswk mqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsaygimf laghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravgvahyl lggivttwafflarslsig
Timeline for d6uzv1_: