Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins) automatically mapped to Pfam PF02427 |
Protein Photosystem I accessory protein E (PsaE) [50095] (5 species) |
Species Synechocystis sp. [TaxId:1111708] [392491] (1 PDB entry) |
Domain d6uzv5_: 6uzv 5: [392497] Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_ automated match to d1gxie_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzv5_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzv5_ b.34.4.2 (5:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. [TaxId: 1111708]} lnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnfa enelelvq
Timeline for d6uzv5_: