![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) ![]() automatically mapped to Pfam PF02507 |
![]() | Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins) |
![]() | Protein automated matches [236583] (4 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [347847] (2 PDB entries) |
![]() | Domain d6uzvf_: 6uzv F: [392520] Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_ automated match to d4kt0f_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzvf_ f.23.16.1 (F:) automated matches {Synechocystis sp. [TaxId: 1111708]} dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa vgeytsgklvmkdseiptspr
Timeline for d6uzvf_: