![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
![]() | Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins) |
![]() | Protein automated matches [236565] (3 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [347611] (2 PDB entries) |
![]() | Domain d6uzvj_: 6uzv j: [392513] Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvl_ automated match to d4kt0j_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzvj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzvj_ f.23.18.1 (j:) automated matches {Synechocystis sp. [TaxId: 1111708]} mdglksflstapvmimalltftagiliefnrfypdllfh
Timeline for d6uzvj_: