Lineage for d6uzv2_ (6uzv 2:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633179Species Synechocystis sp. [TaxId:1111708] [347297] (2 PDB entries)
  8. 2633185Domain d6uzv2_: 6uzv 2: [392591]
    Other proteins in same PDB: d6uzv0_, d6uzv3_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzvc_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_
    automated match to d5l8rb_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv2_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (2:) photosystem I p700 chlorophyll a apoprotein a2

SCOPe Domain Sequences for d6uzv2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzv2_ f.29.1.1 (2:) automated matches {Synechocystis sp. [TaxId: 1111708]}
tkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflwts
gtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgvyh
wfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhlagl
fgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdtagh
ifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighsik
eilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafiaqd
httqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishlsw
vslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpdsi
astawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgalda
rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgv
wsgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgf
mfliswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvlty
aafliastagkfg

SCOPe Domain Coordinates for d6uzv2_:

Click to download the PDB-style file with coordinates for d6uzv2_.
(The format of our PDB-style files is described here.)

Timeline for d6uzv2_: