Lineage for d6uzv3_ (6uzv 3:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556045Species Synechocystis sp. [TaxId:1111708] [347566] (2 PDB entries)
  8. 2556048Domain d6uzv3_: 6uzv 3: [392539]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv4_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvd_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_
    automated match to d5oy0c_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv3_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (3:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d6uzv3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzv3_ d.58.1.2 (3:) automated matches {Synechocystis sp. [TaxId: 1111708]}
shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
flsirvylgaettrsmglay

SCOPe Domain Coordinates for d6uzv3_:

Click to download the PDB-style file with coordinates for d6uzv3_.
(The format of our PDB-style files is described here.)

Timeline for d6uzv3_: