Lineage for d6uzve_ (6uzv e:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393361Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2393377Family b.34.4.2: Photosystem I accessory protein E (PsaE) [50094] (2 proteins)
    automatically mapped to Pfam PF02427
  6. 2393378Protein Photosystem I accessory protein E (PsaE) [50095] (5 species)
  7. 2393390Species Synechocystis sp. [TaxId:1111708] [392491] (1 PDB entry)
  8. 2393392Domain d6uzve_: 6uzv e: [392492]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv4_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzvd_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_
    automated match to d1gxie_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzve_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (e:) photosystem I reaction center subunit IV

SCOPe Domain Sequences for d6uzve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzve_ b.34.4.2 (e:) Photosystem I accessory protein E (PsaE) {Synechocystis sp. [TaxId: 1111708]}
lnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnfa
enelelvq

SCOPe Domain Coordinates for d6uzve_:

Click to download the PDB-style file with coordinates for d6uzve_.
(The format of our PDB-style files is described here.)

Timeline for d6uzve_: