Lineage for d6uzv4_ (6uzv 4:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611448Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily)
    beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail
  4. 2611449Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) (S)
    automatically mapped to Pfam PF02531
  5. 2611450Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins)
  6. 2611461Protein automated matches [236562] (8 species)
    not a true protein
  7. 2611483Species Synechocystis sp. [TaxId:1111708] [347289] (2 PDB entries)
  8. 2611486Domain d6uzv4_: 6uzv 4: [392514]
    Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_
    automated match to d5oy0d_
    complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4

Details for d6uzv4_

PDB Entry: 6uzv (more details), 3.1 Å

PDB Description: the structure of a red shifted photosystem i complex
PDB Compounds: (4:) Photosystem I reaction center subunit II

SCOPe Domain Sequences for d6uzv4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uzv4_ d.187.1.1 (4:) automated matches {Synechocystis sp. [TaxId: 1111708]}
lsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylarke
qclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrrig
qnpepvtikfsgkapyev

SCOPe Domain Coordinates for d6uzv4_:

Click to download the PDB-style file with coordinates for d6uzv4_.
(The format of our PDB-style files is described here.)

Timeline for d6uzv4_: