Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.187: Photosystem I subunit PsaD [64233] (1 superfamily) beta-BETA(2)-beta-alpha-beta(2); antiparallel sheet: order 2134 packed against helix and BETA-hairpin on the same side; irregular C-terminal tail |
Superfamily d.187.1: Photosystem I subunit PsaD [64234] (1 family) automatically mapped to Pfam PF02531 |
Family d.187.1.1: Photosystem I subunit PsaD [64235] (2 proteins) |
Protein automated matches [236562] (8 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [347289] (2 PDB entries) |
Domain d6uzv4_: 6uzv 4: [392514] Other proteins in same PDB: d6uzv0_, d6uzv1_, d6uzv2_, d6uzv3_, d6uzv5_, d6uzv6_, d6uzv7_, d6uzva_, d6uzvb_, d6uzvc_, d6uzve_, d6uzvf_, d6uzvh_, d6uzvi_, d6uzvj_, d6uzvl_ automated match to d5oy0d_ complexed with bcr, ca, cl0, cla, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 6uzv (more details), 3.1 Å
SCOPe Domain Sequences for d6uzv4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uzv4_ d.187.1.1 (4:) automated matches {Synechocystis sp. [TaxId: 1111708]} lsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylarke qclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrrig qnpepvtikfsgkapyev
Timeline for d6uzv4_: