PDB entry 6uzv

View 6uzv on RCSB PDB site
Description: The structure of a red shifted photosystem I complex
Class: photosynthesis
Keywords: Photosystem, Antenna, Chlorophyll, Membrane, PHOTOSYNTHESIS
Deposited on 2019-11-15, released 2020-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv0_
  • Chain '1':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv1_
  • Chain '2':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • PDB 6UZV (Start-734)
    Domains in SCOPe 2.07: d6uzv2_
  • Chain '3':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv3_
  • Chain '4':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv4_
  • Chain '5':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv5_
  • Chain '6':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv6_
  • Chain '7':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzv7_
  • Chain '8':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain '9':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • PDB 6UZV (Start-734)
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvf_
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzva_
  • Chain 'b':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
    • PDB 6UZV (Start-734)
    Domains in SCOPe 2.07: d6uzvb_
  • Chain 'c':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvc_
  • Chain 'd':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvd_
  • Chain 'e':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzve_
  • Chain 'f':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvh_
  • Chain 'i':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvi_
  • Chain 'j':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvj_
  • Chain 'k':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6uzvl_
  • Chain 'm':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CLA, LHG, CL0, PQN, SF4, BCR, LMG, LMT, CA

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >6uzv0 (0:)
    maesnqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyf
    ligpwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgw
    sqfaagffvggmggafvayfllenlsvvdgifrglfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv0 (0:)
    nqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyfligp
    wtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqfa
    agffvggmggafvayfllenlsvvdgifrglfn
    

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >6uzv1 (1:)
    mtisppereakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfds
    qtsdledvsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpi
    vgqgilngdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhy
    hvkapklewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplph
    efilepskmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlai
    avlfiiaghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallg
    sltiivaqhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpak
    nvnnlldrmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqp
    ifaqwvqhlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaf
    tihvtalillkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyn
    slsivifhfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvins
    ygsalsaygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsi
    iqgravgvahyllggivttwafflarslsig
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv1 (1:)
    kvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdledvsrki
    fsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgilngdvgg
    gfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapklewfqn
    vesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefilepskmael
    ypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiiaghmyr
    tnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiivaqhmya
    mppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlldrmlrh
    rdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvqhlhtl
    apgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtalillkg
    vlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhfswk
    mqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsaygimf
    laghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravgvahyl
    lggivttwafflarslsig
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >6uzv2 (2:)
    matkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflw
    tsgtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgv
    yhwfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhla
    glfgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdta
    ghifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighs
    ikeilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafia
    qdhttqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishl
    swvslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpd
    siastawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgal
    dargsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhl
    gvwsgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwat
    gfmfliswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvl
    tyaafliastagkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv2 (2:)
    tkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflwts
    gtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgvyh
    wfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhlagl
    fgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdtagh
    ifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighsik
    eilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafiaqd
    httqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishlsw
    vslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpdsi
    astawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgalda
    rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgv
    wsgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgf
    mfliswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvlty
    aafliastagkfg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >6uzv3 (3:)
    mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt
    dflsirvylgaettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv3 (3:)
    shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
    flsirvylgaettrsmglay
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >6uzv4 (4:)
    mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla
    rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr
    rigqnpepvtikfsgkapyev
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv4 (4:)
    lsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylarke
    qclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrrig
    qnpepvtikfsgkapyev
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >6uzv5 (5:)
    malnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnn
    faenelelvqaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv5 (5:)
    lnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnfa
    enelelvq
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >6uzv6 (6:)
    mkhllalllaftlwfnfapsasaddfanltpcsenpaylaksknflnttndpnsgkirae
    ryasalcgpegyphlivdgrfthagdflipsilflyiagwigwvgrsylieiresknpem
    qevvinvplaikkmlggflwplaavgeytsgklvmkdseiptspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv6 (6:)
    dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
    gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
    vgeytsgklvmkdseiptspr
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >6uzv7 (7:)
    mdglksflstapvmimalltftagiliefnrfypdllfhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzv7 (7:)
    mdglksflstapvmimalltftagiliefnrfypdllfh
    

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6uzvF (F:)
    mkhllalllaftlwfnfapsasaddfanltpcsenpaylaksknflnttndpnsgkirae
    ryasalcgpegyphlivdgrfthagdflipsilflyiagwigwvgrsylieiresknpem
    qevvinvplaikkmlggflwplaavgeytsgklvmkdseiptspr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvF (F:)
    dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
    gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
    vgeytsgklvmkdseiptspr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'a':
    Sequence, based on SEQRES records: (download)
    >6uzva (a:)
    mtisppereakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfds
    qtsdledvsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpi
    vgqgilngdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhy
    hvkapklewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplph
    efilepskmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlai
    avlfiiaghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallg
    sltiivaqhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpak
    nvnnlldrmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqp
    ifaqwvqhlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaf
    tihvtalillkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyn
    slsivifhfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvins
    ygsalsaygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsi
    iqgravgvahyllggivttwafflarslsig
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzva (a:)
    kvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdledvsrki
    fsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgilngdvgg
    gfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapklewfqn
    vesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefilepskmael
    ypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiiaghmyr
    tnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiivaqhmya
    mppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlldrmlrh
    rdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvqhlhtl
    apgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtalillkg
    vlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivifhfswk
    mqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsaygimf
    laghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravgvahyl
    lggivttwafflarslsig
    

  • Chain 'b':
    Sequence, based on SEQRES records: (download)
    >6uzvb (b:)
    matkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflw
    tsgtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgv
    yhwfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhla
    glfgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdta
    ghifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighs
    ikeilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafia
    qdhttqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishl
    swvslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpd
    siastawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgal
    dargsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhl
    gvwsgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwat
    gfmfliswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvl
    tyaafliastagkfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvb (b:)
    tkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflwts
    gtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgvyh
    wfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhlagl
    fgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdtagh
    ifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighsik
    eilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafiaqd
    httqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishlsw
    vslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpdsi
    astawpnygnvwlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgalda
    rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgv
    wsgnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgf
    mfliswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvlty
    aafliastagkfg
    

  • Chain 'c':
    Sequence, based on SEQRES records: (download)
    >6uzvc (c:)
    mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt
    dflsirvylgaettrsmglay
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvc (c:)
    shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
    flsirvylgaettrsmglay
    

  • Chain 'd':
    Sequence, based on SEQRES records: (download)
    >6uzvd (d:)
    mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla
    rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr
    rigqnpepvtikfsgkapyev
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvd (d:)
    lsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylarke
    qclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrrig
    qnpepvtikfsgkapyev
    

  • Chain 'e':
    Sequence, based on SEQRES records: (download)
    >6uzve (e:)
    malnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnn
    faenelelvqaaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzve (e:)
    lnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnfa
    enelelvq
    

  • Chain 'f':
    No sequence available.

  • Chain 'h':
    Sequence, based on SEQRES records: (download)
    >6uzvh (h:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihiesegeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvh (h:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihiese
    

  • Chain 'i':
    Sequence, based on SEQRES records: (download)
    >6uzvi (i:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihiesegeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvi (i:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihiese
    

  • Chain 'j':
    Sequence, based on SEQRES records: (download)
    >6uzvj (j:)
    mdglksflstapvmimalltftagiliefnrfypdllfhp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvj (j:)
    mdglksflstapvmimalltftagiliefnrfypdllfh
    

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    Sequence, based on SEQRES records: (download)
    >6uzvl (l:)
    maesnqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyf
    ligpwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgw
    sqfaagffvggmggafvayfllenlsvvdgifrglfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6uzvl (l:)
    nqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyfligp
    wtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqfa
    agffvggmggafvayfllenlsvvdgifrglfn
    

  • Chain 'm':
    No sequence available.