SCOPe 2.08: Domain d3oeer_: 3oee R:

Lineage for d3oeer_ (3oee R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)
   automatically mapped to Pfam PF04627

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)

8. Domain d3oeer_: 3oee R: [294215]
   Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_
   automated match to d2hldi_
   complexed with anp, mg, po4; mutant

Details for d3oeer_

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (R:) ATP synthase subunit epsilon

SCOPe Domain Sequences for d3oeer_:

Sequence, based on SEQRES records:

>d3oeer_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yaaylnvaaqairsslktelqtasvlnrsqtdafytqy

Sequence, based on observed residues (ATOM records):

>d3oeer_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yaaylnvaaqairtelqtasvlnrsqtdafytqy

Timeline for d3oeer_:

• d3oeer_ first appeared in SCOPe 2.06
  
• d3oeer_ appears in SCOPe 2.07