Lineage for d3oeey_ (3oee Y:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881031Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2881032Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2881033Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310899] (6 PDB entries)
  8. 2881039Domain d3oeey_: 3oee Y: [182958]
    Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3
    automated match to d1bmfg_
    complexed with anp, mg, po4; mutant

Details for d3oeey_

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (Y:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oeey_:

Sequence, based on SEQRES records: (download)

>d3oeey_ c.49.2.1 (Y:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgas

Sequence, based on observed residues (ATOM records): (download)

>d3oeey_ c.49.2.1 (Y:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmditsdkglcgsihsql
akavrrhlndqpnavtigdkikmqllrthpningigkdaptfqesaliadkllsvmkais
ifyndpvsslsfepseytlanqmltamaqgyaaeisarrnamdnasknagdminrysily
nrtrqavitnelvdiitgas

SCOPe Domain Coordinates for d3oeey_:

Click to download the PDB-style file with coordinates for d3oeey_.
(The format of our PDB-style files is described here.)

Timeline for d3oeey_: