Lineage for d3oeef2 (3oee F:83-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869554Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2869557Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries)
  8. 2869569Domain d3oeef2: 3oee F:83-357 [239543]
    Other proteins in same PDB: d3oeed1, d3oeed3, d3oeee1, d3oeee3, d3oeef1, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem3, d3oeen1, d3oeen3, d3oeeo1, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev3, d3oeew1, d3oeew3, d3oeex1, d3oeex3, d3oeey_
    automated match to d2jdid3
    complexed with anp, mg, po4; mutant

Details for d3oeef2

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (F:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeef2 c.37.1.11 (F:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

SCOPe Domain Coordinates for d3oeef2:

Click to download the PDB-style file with coordinates for d3oeef2.
(The format of our PDB-style files is described here.)

Timeline for d3oeef2: