Lineage for d3oeem3 (3oee M:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717384Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)
  8. 2717397Domain d3oeem3: 3oee M:358-475 [239547]
    Other proteins in same PDB: d3oeed1, d3oeed2, d3oeee1, d3oeee2, d3oeef1, d3oeef2, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeen1, d3oeen2, d3oeeo1, d3oeeo2, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeew1, d3oeew2, d3oeex1, d3oeex2, d3oeey_
    automated match to d2jdid1
    complexed with anp, mg, po4; mutant

Details for d3oeem3

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (M:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeem3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeem3 a.69.1.1 (M:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

SCOPe Domain Coordinates for d3oeem3:

Click to download the PDB-style file with coordinates for d3oeem3.
(The format of our PDB-style files is described here.)

Timeline for d3oeem3: