| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries) |
| Domain d3oeen3: 3oee N:358-475 [239550] Other proteins in same PDB: d3oeed1, d3oeed2, d3oeee1, d3oeee2, d3oeef1, d3oeef2, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeen1, d3oeen2, d3oeeo1, d3oeeo2, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeew1, d3oeew2, d3oeex1, d3oeex2, d3oeey_ automated match to d2jdid1 complexed with anp, mg, po4; mutant |
PDB Entry: 3oee (more details), 2.74 Å
SCOPe Domain Sequences for d3oeen3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeen3 a.69.1.1 (N:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
Timeline for d3oeen3:
View in 3DDomains from other chains: (mouse over for more information) d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_ |