| Class b: All beta proteins [48724] (180 folds) |
| Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) ![]() |
| Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins) |
| Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species) delta subunit in mitochondria |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries) |
| Domain d3oeeh1: 3oee H:11-90 [294212] Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_ automated match to d2hldh1 complexed with anp, mg, po4; mutant |
PDB Entry: 3oee (more details), 2.74 Å
SCOPe Domain Sequences for d3oeeh1:
Sequence, based on SEQRES records: (download)
>d3oeeh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffi
sggfatvqpdsqlcvtaiea
>d3oeeh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
gfatvqpdsqlcvtaiea
Timeline for d3oeeh1:
View in 3DDomains from other chains: (mouse over for more information) d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_ |