SCOPe 2.07: Domain d3oeeh1: 3oee H:11-90

Lineage for d3oeeh1 (3oee H:11-90)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries)

8. Domain d3oeeh1: 3oee H:11-90 [294212]
   Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_
   automated match to d2hldh1
   complexed with anp, mg, po4; mutant

Details for d3oeeh1

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (H:) ATP synthase subunit delta

SCOPe Domain Sequences for d3oeeh1:

Sequence, based on SEQRES records:

>d3oeeh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffi
sggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records):

>d3oeeh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
gfatvqpdsqlcvtaiea

Timeline for d3oeeh1:

• d3oeeh1 first appeared in SCOPe 2.06