SCOPe 2.08: Domain d3oeeg_: 3oee G:

Lineage for d3oeeg_ (3oee G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
   automatically mapped to Pfam PF00231

6. Protein F1 ATP synthase gamma subunit [52945] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310899] (6 PDB entries)

8. Domain d3oeeg_: 3oee G: [182956]
   Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3
   automated match to d1bmfg_
   complexed with anp, mg, po4; mutant

Details for d3oeeg_

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (G:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oeeg_:

Sequence, based on SEQRES records:

>d3oeeg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records):

>d3oeeg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi
ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq
spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr
ysilynrtrqavitnelvdiitgass

Timeline for d3oeeg_:

• d3oeeg_ first appeared in SCOPe 2.01
  
• d3oeeg_ appears in SCOPe 2.07