SCOPe 2.08: Domain d3oeeo2: 3oee O:83-357

Lineage for d3oeeo2 (3oee O:83-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310897] (6 PDB entries)

8. Domain d3oeeo2: 3oee O:83-357 [239552]
   Other proteins in same PDB: d3oeed1, d3oeed3, d3oeee1, d3oeee3, d3oeef1, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem3, d3oeen1, d3oeen3, d3oeeo1, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev3, d3oeew1, d3oeew3, d3oeex1, d3oeex3, d3oeey_
   automated match to d2jdid3
   complexed with anp, mg, po4; mutant

Details for d3oeeo2

PDB Entry: 3oee, 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S

PDB Compounds: (O:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oeeo2:

Sequence; same for both SEQRES and ATOM records:

>d3oeeo2 c.37.1.11 (O:83-357) Central domain of beta subunit of F1 ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isvpvgretlgriinvigepidergpiksklrkpihadppsfaeqstsaeiletgikvvd
llapyarggkiglfggagvgktvfiqelinniakahggfsvftgvgertregndlyremk
etgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdeegqdvllfidnifrft
qagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsvqavyvpaddltdpap
attfahldattvlsrgiselgiypavdpldsksrl

Timeline for d3oeeo2:

• d3oeeo2 first appeared in SCOPe 2.04
  
• d3oeeo2 appears in SCOPe 2.07