![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries) |
![]() | Domain d3oeex1: 3oee X:7-82 [239560] Other proteins in same PDB: d3oeed2, d3oeed3, d3oeee2, d3oeee3, d3oeef2, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem2, d3oeem3, d3oeen2, d3oeen3, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev2, d3oeev3, d3oeew2, d3oeew3, d3oeex2, d3oeex3, d3oeey_ automated match to d2jdid2 complexed with anp, mg, po4; mutant |
PDB Entry: 3oee (more details), 2.74 Å
SCOPe Domain Sequences for d3oeex1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeex1 b.49.1.1 (X:7-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg teglvrgekvldtggp
Timeline for d3oeex1:
![]() Domains from other chains: (mouse over for more information) d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeeg_, d3oeeh1, d3oeeh2, d3oeei_, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeer_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeey_ |