PDB entry 3oee

View 3oee on RCSB PDB site
Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
Class: hydrolase
Keywords: ATP synthase, ATP phosphatase, f1f0 ATPase, ATP synthesis, hydrolase, ADP, po4, mitochondria
Deposited on 2010-08-12, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'B':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'C':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'D':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeed1, d3oeed2, d3oeed3
  • Chain 'E':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeee1, d3oeee2, d3oeee3
  • Chain 'F':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeef1, d3oeef2, d3oeef3
  • Chain 'G':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeeg_
  • Chain 'H':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeeh1, d3oeeh2
  • Chain 'I':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeei_
  • Chain 'J':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'K':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'L':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'M':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeem1, d3oeem2, d3oeem3
  • Chain 'N':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeen1, d3oeen2, d3oeen3
  • Chain 'O':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeeo1, d3oeeo2, d3oeeo3
  • Chain 'P':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeep_
  • Chain 'Q':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: ATP synthase subunit epsilon
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP15, YPL271W, P0345
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeer_
  • Chain 'S':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'T':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'U':
    Compound: ATP synthase subunit alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP1, YBL099W, YBL0827
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07251
      • engineered mutation (404)
  • Chain 'V':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeev1, d3oeev2, d3oeev3
  • Chain 'W':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeew1, d3oeew2, d3oeew3
  • Chain 'X':
    Compound: ATP synthase subunit beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2, YJR121W, J2041
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeex1, d3oeex2, d3oeex3
  • Chain 'Y':
    Compound: ATP synthase subunit gamma
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP3, ATP3a, ATP3b, YBR039W, YBR0408
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3oeey_
  • Chain 'Z':
    Compound: ATP synthase subunit delta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP16, YDL004W, YD8119.03, D2935
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3oeeD (D:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeD (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3oeeE (E:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeE (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3oeeF (F:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeF (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3oeeG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi
    ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq
    spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr
    ysilynrtrqavitnelvdiitgass
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3oeeH (H:)
    aeaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevm
    egsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdarea
    aeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeH (H:)
    klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
    gfatvqpdsqlcvtaieaplesfseniknllaeakknvsssdareaaeaaiqvevlenlq
    sv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3oeeI (I:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeI (I:)
    isyaaylnvaaqairsktelqtasvlnrsqtdafytqyknaseptpitk
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3oeeM (M:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeM (M:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3oeeN (N:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeN (N:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3oeeO (O:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeO (O:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3oeeP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
    livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
    fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktidtdanvprdlfey
    tlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdiit
    gass
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3oeeR (R:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeR (R:)
    yaaylnvaaqairtelqtasvlnrsqtdafytqy
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3oeeV (V:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeV (V:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >3oeeW (W:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeW (W:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3oeeX (X:)
    ashhhhhhaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhl
    gentvrtiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklr
    kpihadppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinni
    akahggfsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararval
    tgltiaeyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqe
    ritttkkgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsk
    srlldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrfl
    sqpfavaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    aean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeX (X:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3oeeY (Y:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oeeY (Y:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmditsdkglcgsihsql
    akavrrhlndqpnavtigdkikmqllrthpningigkdaptfqesaliadkllsvmkais
    ifyndpvsslsfepseytlanqmltamaqgyaaeisarrnamdnasknagdminrysily
    nrtrqavitnelvdiitgas
    

  • Chain 'Z':
    No sequence available.