SCOPe 2.08: Domain d2b9p51: 2b9p 5:2-59

Lineage for d2b9p51 (2b9p 5:2-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
   Uniprot P80339 1-59

8. Domain d2b9p51: 2b9p 5:2-59 [144978]
   Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1, d2b9pz1
   protein/RNA complex
   protein/RNA complex

Details for d2b9p51

PDB Entry: 2b9p, 6.46 Å

PDB Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.

PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d2b9p51:

Sequence; same for both SEQRES and ATOM records:

>d2b9p51 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d2b9p51:

• d2b9p51 first appeared in SCOP 1.75
  
• d2b9p51 appears in SCOPe 2.07