Class b: All beta proteins [48724] (180 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) |
Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries) |
Domain d2b9pz1: 2b9p Z:1-175 [144984] Other proteins in same PDB: d2b9p01, d2b9p21, d2b9p31, d2b9p51, d2b9p71, d2b9p81, d2b9p91, d2b9pf1, d2b9ph1, d2b9ph2, d2b9pi1, d2b9pi2, d2b9pk1, d2b9pk2, d2b9pn1, d2b9po1, d2b9pr1, d2b9pt1, d2b9pu1, d2b9pv1, d2b9pw1, d2b9px1, d2b9py1 protein/RNA complex protein/RNA complex has additional subdomain(s) that are not in the common domain |
PDB Entry: 2b9p (more details), 6.46 Å
SCOPe Domain Sequences for d2b9pz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9pz1 b.53.1.1 (Z:1-175) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr
Timeline for d2b9pz1: